hydrafacialatskinrevivemdspa.com valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
Meta Tags
| Title | Oak Lawn, Illinois Med Spa | Skin Revive |
| Description | $179 for Hydrafacial MD WITH 1 An upscale Med Spa conveniently located in Oak Lawn, Illinois |
| Keywords | N/A |
Server Information
| WebSite | |
| Host IP | 75.2.70.75 |
| Location | United States |
Related Websites
| Site | Rank |
More to Explore
hydrafacialatskinrevivemdspa.com Valuation
|
US$837,420
Last updated: 2023-05-19 07:02:51
hydrafacialatskinrevivemdspa.com has Semrush global rank of 12,639,194. hydrafacialatskinrevivemdspa.com has an estimated worth of US$ 837,420, based on its estimated Ads revenue. hydrafacialatskinrevivemdspa.com receives approximately 96,626 unique visitors each day. Its web server is located in United States, with IP address 75.2.70.75. According to SiteAdvisor, hydrafacialatskinrevivemdspa.com is safe to visit. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$837,420 |
| Daily Ads Revenue | US$774 |
| Monthly Ads Revenue | US$23,191 |
| Yearly Ads Revenue | US$278,281 |
| Daily Unique Visitors | 6,442 |
| Note: All traffic and earnings values are estimates. | |
DNS Records
| Host | Type | TTL | Data |
| hydrafacialatskinrevivemdspa.com. 600 IN A | A | IP: 75.2.70.75 | |
| hydrafacialatskinrevivemdspa.com. 600 IN A | A | IP: 99.83.190.102 | |
| hydrafacialatskinrevivemdspa.com. 3600 IN NS | NS | NS Record: ns73.domaincontrol.com. | |
| hydrafacialatskinrevivemdspa.com. 3600 IN NS | NS | NS Record: ns74.domaincontrol.com. |
HtmlToTextCheckTime:2023-05-19 07:02:51
| About HydraFacial Our Approach Testimonials (708) 393-1051 Book Appointment Book Menu Days Hours Minutes Seconds $179 for Hydrafacial MD WITH 1 Booster 3 Steps. Less than 30 minutes. The BEST skin of your life! Book Appointment Watch Video Only HydraFacial uses patented technology to cleanse, extract, and hydrate. HydraFacial super serums are made with nourishing ingredients that create an instantly gratifying glow in just 3 steps: Cleanse + Peel Uncover a new layer of skin with gentle exfoliation and relaxing resurfacing. Extract + Hydrate Remove debris from pores with painless suction. Nourish with intense moisturizers that quench skin. Fuse + Protect Saturate the skin’s surface with antioxidants and peptides to maximize your glow. Is HydraFacial right for you? Yep. We don’t have a type. Hydrafacial addresses all skincare needs. FINE LINES + WRINKLES ELASTICITY + FIRMNESS EVEN TONE + VIBRANCY SKIN TEXTUREBROWN SPOTSOILY + CONGESTED SKINENLARGED PORES Book Appointment Exfoliate, |
HTTP Headers
HTTP/1.1 301 Moved Permanently Server: openresty Date: Sat, 10 Sep 2022 09:33:15 GMT Content-Type: text/html Content-Length: 166 Connection: keep-alive Location: https://hydrafacialatskinrevivemdspa.com/ HTTP/2 301 server: openresty date: Sat, 10 Sep 2022 09:33:15 GMT content-type: text/html content-length: 166 location: https://www.hydrafacialatskinrevivemdspa.com/ HTTP/2 200 server: openresty date: Sat, 10 Sep 2022 09:33:16 GMT content-type: text/html content-length: 52255 via: 1.1 varnish, 1.1 varnish accept-ranges: bytes age: 0 x-served-by: cache-iad-kjyo7100080-IAD, cache-dub4336-DUB x-cache: MISS, MISS x-cache-hits: 0, 0 x-timer: S1662802396.084861,VS0,VE203 vary: x-wf-forwarded-proto, Accept-Encoding x-cluster-name: eu-west-1-prod-edge-blue |
hydrafacialatskinrevivemdspa.com Whois Information
Domain Name: HYDRAFACIALATSKINREVIVEMDSPA.COM Registry Domain ID: 2691251418_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2022-04-22T20:37:51Z Creation Date: 2022-04-22T20:37:50Z Registry Expiry Date: 2023-04-22T20:37:50Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: 480-624-2505 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Name Server: NS73.DOMAINCONTROL.COM Name Server: NS74.DOMAINCONTROL.COM DNSSEC: unsigned >>> Last update of whois database: 2022-09-10T09:39:51Z <<< |